Full stack developer jobs in Greater Kailash, India

We're building Indiascope, an AI-powered platform for Indian history, culture & storytelling. · Looking for a Full Stack Developer with experience in Python /Java and React to help build search, timeline and AI-driven content systems. · ...

We are seeking a skilled Full Stack Developer to design, develop and maintain scalable web applications. We need someone with experience in front-end and back-end technologies. · ...

We are searching for a talented and motivated Full Stack Developer to join our innovative team. · ...

We are searching for a talented and motivated Full Stack Developer to join our innovative team. · ...

We are hiring a Full-Stack Developer with experience in Angular and PHP (Laravel) to work on live web applications. · Develop responsive web applications using AngularBuild and maintain RESTful APIs using PHP and LaravelIntegrate frontend UI with backend services ...

We are seeking a highly motivated and skilled developer to join our dynamic team. · ...

Cure My Knee (CMK), established in 2020, is a next-generation healthcare system built on a strong foundation of trust and guided by four core pillars: Talent, Technology, Service, and Care. · ...

We are looking for an experienced Full Stack Developer with 3–5 years of hands-on experience in building and scaling SaaS platforms. · This role involves working on revamping and scaling our internal commerce platform, · integrating WMS and OMS systems, · and implementing secure, ...

WeSolveForYouisadynamicandinovativecompanydedicatedtosolvingcomplexproblemsfore-commercebusinesses.WebuildingAtom-anadvanceddataanalyticsplatformdesignedtoempowere-commercebusinesseswithdeepinsightsanddatadrivenstrategies tooptimizeoperations,boostsales,andincreaseefficiency. · B ...

We are hiring a Full Stack Developer who can design & build modern websites, do backend coding, develop AI chatbots, and work on automation tools like N8N. · ...

We are looking for a Full Stack Developer with hands-on experience in Java and Spring Boot to support end-to-end development of business-critical applications. · Develop and maintain backend services using Java & Spring Boot · Build and integrate RESTful APIs for web applications ...

We're hiring a Full Stack Developer with strong hands-on experience across cloud (AWS & GCP), mobile app development (Android & iOS), and enterprise-grade software systems. · Build and maintain scalable full-stack applications (web + mobile) · Develop and manage Android & iOS mob ...

We are looking for skilled Full Stack Developers to join our team, a next-generation B2B SaaS platform for the maritime and supply chain industry. · You'll work across the entire technology stack — from backend microservices built on .NET Core, EF Core, and PostgreSQL/MongoDB, to ...

Job summary · We're looking for a hands-on Full Stack Developer who can take ownership of backend frontend and deployments. · ...

We are seeking experienced Full Stack Developers (.NET Core + Flutter) to join our engineering team and contribute to the development of a next-generation B2B SaaS platform in the maritime and supply chain domain. · ...

We are looking for a Full-Stack Tech Developer to handle end-to-end technical work across our platforms. · We will involve working on a wide range of technical requirements as the business grows. · -Mobile First Development · a.Design build and maintain consumer facing mobile app ...

We are looking for an experienced Full Stack Developer to design, develop, and maintain scalable web applications. The ideal candidate should be strong in Nodejs / Nextjs/ Typescript / MongoDB Fullstack. · ...

We are looking for a Full Stack Developer to join our team and help build this ecosystem from the ground up. · You will work on both frontend and backend developing APIs, portals, and integrations that power multiple modules. · ...

We are looking for an experienced Full Stack Developer to design, develop, and maintain scalable web applications.The ideal candidate should be strong in , , TypeScript, and MongoDB, with hands-on experience in cloud platforms, CI/CD pipelines, and security best practices. · Desi ...

We're looking for a Full Stack Developer with a strong software engineering foundation to help build, scale, and deploy production-grade GenAI products. · You'll work closely with our Head of AI, complementing their applied AI expertise with your hands-on experience in system des ...