-
Solution Architect
1 day ago
Webhelp Gurgaon, India**IT & Technical support** · **Location** · - Gurugram, India**Language** · - English*** · **Job Advert**: · Do you have solutions architect experience, and are you looking for a new opportunity in Gurgaon? Webhelp is seeking a flexible, full-time Solutions Architect, and the rol ...
-
IT Solution Architect
1 day ago
DB Schenker Gurgaon, India**Your tasks**: · **Requirements**: · - Study to university degree level (computer science or related disciplines) · - At least 6 years of relevant work experience in designing IT solutions · - Experience with microservices, REST API/GraphQL and event-based processing · - Knowled ...
-
Ip Solution Architect
18 hours ago
NOKIA Gurgaon, IndiaSolution Architect - IP/MPLS & Cloud-SDN · **Goal**: · Contribute to and support the Architecture, Technical Scope of Work (SOW) and Solution Description for the Customer project. Assist internal teams from offer commencement through to final solution delivery and acceptance by t ...
-
Aws Solution Architect
1 day ago
Rackspace Gurgaon, India**Key Responsibilities** · - Building and proposing Solution Architecture, High and Low-Level Design. · - Helping multiple customers in their Cloud Migration, Scoping, Solution Sizing, Technical Proposal, Cloud Assessment & Readiness, Platform Evaluation, TCO analysis, Bill of Ma ...
-
Solution Architect-iot
1 day ago
Maruti Suzuki India Ltd Gurgaon, IndiaNumber of Vacant Positions-1 · Division Digital Enterprise - Maruti Suzuki India Limited · Department-IoT · Job Location-Gurgaon · Job Role-Solution architect · Level in the organization-DM/MGR · Educational Qualification-Graduation and Post Graduation · **"Graduation -(With Spec ...
-
Solution Architect(Pr5010)
18 hours ago
Skillety Technologies Gurugram, Haryana, IndiaHi, · We are recruiting for the following requirement. · **Skill: Solution Architect** · **Exp: 12-15yrs** · **Location: Gurgaon** · **You'll be responsible for (Responsibilities)**: · - Strong experience with cloud computing platforms (AWS,AWS KMS, EMR, VPC, Route53, API Gateway ...
-
Data Solutions Architect
18 hours ago
Luxoft Gurugram, Haryana, India**Project** Description**: · We have an opportunity with one of the biggest banking clients. Here you will join their long-term digital transformation programme as part of the Data & DevOps Team. · **Responsibilities**: · - Key Responsibilities: · - Analysis of problem statement, ...
-
Aws Solution Architect
2 days ago
Talentpull & Infrastructure Gurgaon, India**- Good programming skills in any language (Java/Node/Angular etc.) and should be able to devise the solution of the given problem statement.** · **- Should have good knowledge in Web Applications / API standards, documentation and Operations.** · **- Should be flexible enough t ...
-
Advisory Solution Architect
1 day ago
Lenovo Gurugram, Haryana, India**General Information**: · - Req #- WD Career area: · - Information Technology- Country/Region: · - India- State: · - Haryana- City: · - Gurgaon- Date: · - Wednesday, March 6, 2024- Working time: · - Full-time**Additional Locations**: · - India - Haryāna - Gurgaon · - India - Har ...
-
Security Solutions Architect
2 days ago
Orange Gurugram, Haryana, IndiaMake security solutions decisions. · - Develop & propose Security Architecture for new & existing network & services. · - Providing network security architecture and design services that define Network Security Standards for Orange Wholesale. · - Identify opportunities to improve ...
-
Integration Solution Architect
18 hours ago
McCormick & Company Gurgaon Road, IndiaDelhi, India · The Integration Solution Architect works with stakeholders to translate functional and nonfunctional requirements into integration interfaces and implementations. The Architect will be responsible for developing solutions for fit and scalability, while ensuring tha ...
-
Solutions Architect, South Apac
1 day ago
Criteo Gurgaon, India**What You'll Do**: · Part of the Client Solutions organization, the Solutions Architect will be the voice of the Product team in both internal and external settings. They will be responsible with providing expertise & guidance to both our retail partners and commercial team to d ...
-
Associate Solutions Architect I
18 hours ago
MongoDB Gurugram, Haryana, IndiaThe worldwide data management software market is massive (According to IDC, the worldwide database software market, which it refers to as the database management systems software market, was forecasted to be approximately $82 billion in 2023 growing to approximately $137 billion ...
-
Solution Architect- Enterprise Private Networks
18 hours ago
Airtel India Gurgaon, Gurugram, Haryana, India**Responsibilities**: · - Be responsible for customer requirement documentation, scope, definition and crafting end-end solution, Creating solution proposals. · - Funnel building for new solutions /use cases/ architecture for Industry 4.0 verticals. · - Lead discussions with inte ...
-
Solution Architect
18 hours ago
FourBrick Technology OPC Pvt. Ltd. Noida, IndiaWe are looking for a Solution Architect to join our team and implement systems architecture to help solve to our clients solution. · Solution Architect responsibilities include testing and integrating program software systems to address and solve specific business problems within ...
-
Solution Architect
18 hours ago
FutureSoft India Delhi, Delhi, India**Experience** · 8-16 Years · **Qualification** · B. tech/ IT Degree · **Skills** · Based on requirement discussions with client and on basis of functional requirement document, creating technical architecture and design(HLD and LLD) · **Location** · New Delhi · **No. of Position ...
-
Solution Architect
2 days ago
Infinite Computer Solutions Ltd. Noida, IndiaKey Skills - Architect AWS Security, Zero Trust, Mitre Attack Framework, NIST, CIS, PCI-DSS, (Terraform) etc · - Detailed JD: · - **Security**: · - Deep understanding of security principles and **frameworks such as Zero Trust, Mitre Attack Framework, NIST, CIS, PCI-DSS, etc.**: · ...
-
Solution Architect
18 hours ago
Bentley Systems Delhi, India**Solution Architect - Transportation** · **Location**:Delhi, India · **Position Summary**: · As the Solution Architect in Solution Engineering (SE)), your role is pivotal in driving the growth of Annual Recurring Revenue (ARR) in APAC as a brand specialist who is a Transportatio ...
-
Solution Architect
1 day ago
Trigyn Delhi, IndiaPosition Id: G · **Job Type**:Full Time · Country: India · - Location: Delhi- Pay Rate: Open- Contact Recruiter: · -**: · Trigyn has immediate requirement for a Solution Architect. · Any cloud architect certification (must) · Current salary should be more than 47 lakhs. (must) ...
-
Solution Architect
18 hours ago
NOKIA Noida, India**Come create the technology that helps the world act together** · Nokia is committed to innovation and technology leadership across mobile, fixed and cloud networks. Your career here will have a positive impact on people's lives and will help us build the capabilities needed for ...
SOFAC Senior Solution Architect - Gurugram, India - Kearney
Description
Who we areAsaglobalconsultingpartnershipinmorethan40countries,ourpeoplemakeuswhoweare.We'reindividualswith different passions and strengths who take as much joy in the work we do as from those we work with.
Kearney'sDigitalSolutionsFactory[SOFAC] isarapidlygrowingengineeringteamthatisbuildingthenextgeneration of solutions for our clients. As a part of this team, you will:
· Developcutting-edge,cloudnativedigitalproductsandsolutions,poweredbyadvancedanalytics
· Learnfromseasonedthoughtleadersanddomainexperts
· Partnerwithourglobalconsultantsacrossindustriesthatdrivestrategydefinitiontocreatevalueforourclientsin ever changing market conditions
· Collaboratewithleadingsystemintegratorsandcloudprovidersinavarietyofdeliverymodels todefine, standardize and mature product delivery life cycle
Abouttherole
For SeniorSolutionArchitect position,we areseekingan enthusiasticandpassionate solutionarchitect withextensive experienceinarchitectingenterprisegradecloudnativeapplicationsin AzureorAWS.Thisrolewillsupportandfacilitate the innovation and adoption of next-generation technologies.
Thisrolewillworkcloselywithdevelopmentteams,Infrastructure,SecurityandNetworkEngineering,DevOps,Enterprise architecture and other stakeholders, collaborating as a subject matter expert [SME] with technology, business, information, domain and solution architects. This role will also play a key role in developing long-term strategies and roadmaps, using architecture methodologies and security frameworks, to strengthen the overall information security posture.
Responsibilities
· Leadend-to-endtechnologysolutionsandapplicationarchitectures,andprogrammaticintegrationofcloud applications, data services, and infrastructure
· Actasthetechnologysolutionexpertincloudandapplicationdesignframeworks
· Identifyanddefinethebestfitsolutionsandacceleratorsforfront-end,back-end,integration,anddataarchitecture
· Coordinatecross-teamcommunicationandfacilitatereviewingoftechnicalissuesforthetechnicalgovernance forums, multi-vendor solutions/proposals
· Leadsocializationofthetechnicaldecisionswiththeprojectteams
· Reviewapplicationsolutiondesignsforcloud-fit,secure,scalable,performant,andreusablepatterns
· Useindustrystandardsecurityarchitectureframeworks withfocusonqualityattributesofconfidentiality,integrity,and availability
· Identifyandresearchrelevanttechnologies,performproofsofconcept/prototypes,andrecommendtheapplications of such technologies for future product architecture
· Identifyandcommunicaterisks(business,application,technical)associatedwithcomponentorapplication implementation
· ParticipatewithAgileteamsanddocumenthigh-leveldesignandhand-offworktonextgroupinthedevelopment pipeline
· Reviewdeliveryteam'sdetaildesignforarchitectureandhigh-leveldesignalignmentwithdataflowsinmind
· Partnerdirectlywithtechnologyandengineeringontheidentification,development,andreviewofarchitecturedesign patterns
· Coachandmentorteamstoincorporatesecurityintoallcustomer-facingapplicationswithappropriatedataisolation and need based, zero-trust access policies
· Developapplicationanddataarchitecturemodelstofurtherenableeffectiveservice-orienteddelivery.Identify opportunities to strengthen the capability of the technology organization
KeyRequirements
· 12-15yearsofbroadITexperienceindesigningandarchitectingend-to-endsolutionsforlargescaleenterprise grade on-prem and cloud hosted web applications
· Establishedtrackrecordinhandlingmultipleprojectsandpriorities
· CertifiedCloudSolutionArchitectProfessional(AzureorAWS)orequivalentexperience
· Hands-onexperiencingindesigningandconfiguringsecureandscalablecloudplatformspatternsonAWSorAzure
· Deepunderstandingofvariousclouddesignpatterns,cloudnativearchitectureandprinciples,cloud operationsand cloud security, serverless and containerized solutions, data cataloguing and management, Identity Management, Developer tools, Caching, SQL/No SQL DBs, DevOps (CI/CD pipelines, ML Ops) etc.
· Excellentunderstandingofapplicationsecurityarchitecture,APISecuritybestpracticesandprinciples,commondata protection technologies (this includes implementation), such as Cryptography, Tokenization, Hashing, etc.
· Strongknowledgeofnetworksecurityprotocolsandbestpractices,Threatmodeling andRiskAssessment methodologies and/or frameworks, Azure/AWS native security services and security best practices
· ExperiencewithMicro-servicesandEventdrivenarchitecture,APIdesignandmanagement(webservices,REST, Web API, ESB, message-based) development, integration, and deployment
· Strongfacilitation,negotiation,interpersonal,communication,collaboration,andleadershipskills,capableofleading less experienced architects
· Demonstratedabilitytoeasilydealwithbothabstractandconcrete conceptsand beabletoreconcilethemforthe appropriate audience and context
· Provenabilitytomaintainbothastrategiclong-termoutlookandenterpriseperspective,whilealsosupporting tangible, business-driven and IT-delivered solutions
· Abilitytocommunicateacrossbusinessunitsandtheabilitytointerfacewithandcommunicatecomplextechnical concepts to a broad range of internal and external stakeholders
· Abilitytolearn/internalizeexistinginformationtoassistseveralprojectseffectivelyandimmediately.Abletorelateto end-to-end business processes and data flows into solutions with a goal of simplifying the business process and improving experience
· Experiencewithcloud-baseddataarchitecture/dataservices.Exposuretostreamingdataservicesandnon- relational data sources
· Experienceinsecurityintegrationpatternstosecuresensitivedatainacloudenvironmentandbeabletosharedata between multiple cloud vendors and hybrid-cloud environments
· ExperienceworkingwithvariousOSandgoodknowledgeofvariousprogrammingframeworksandlanguages
· Self-motivatedwithapositiveattitudeandanabilitytoworkindependentlyaswellasinateam
DesirableRequirements
· ExperienceinSupplyChain,DataAnalytics,AI,Insights,and/orAutomation
· ExperienceinSnowflakeandDatabricksishighlypreferred
· Hands-onexperienceinapplicationdevelopmentusingfullstacktechnologies
· AdditionalCloudDeveloper,Securityand/orDevOpscertificationsarehighlydesirable
TechStack
Python,Java,Flask/Django/ExpressJS/.NetCore/Springboot,Vue/React/Angular,NPM,,MySQL,NoSQL(Mongo, neo4j), Snowflake, Data bricks, Redis, Kafka, Kendo UI, Charts, D3, Java script, HTML, CSS, PHP, JQuery, Forms, Validations, Micro Services, Data Object Models, Java/Spring, Power BI, Azure DevOps, GitHub, Postman, SonarQube, Google and Adobe Analytics, SAML, OAuth / JWT, Key Vault, Kerbros Authentication, Data Lakes, Kubernetes, Docker
Infrastructure
AzureCloud,WindowsandLinuxServers(Windows,Linux,Ubuntu,CentOS),ContainerizedandServerless
EqualEmploymentOpportunityandNon-Discrimination
Kearneypridesitselfonprovidingaculturethatallows employeestobringtheirbestselvestoworkeveryday.Ourpeople canfeelcomfortable,confident, andjoyfultodo greatthings for our firm, our colleagues, and our clients.Kearney aims to build diverse capabilities to help our clients solve their most mission critical problems.
Kearneyiscommittedtobuildingadiverse,unbiasedandinclusiveworkforce.Kearneyisanequalopportunityemployer; werecruit,hire,train,promote,develop,andprovideotherconditionsof employmentwithoutregardtoaperson'sgender identity or expression, sexual orientation, race, religion, age, national origin, disability, marital status, pregnancy status, veteran status, genetic information or any other differences consistent with applicable laws. This includes providingreasonableaccommodationfordisabilities,orreligiousbeliefsandpractices.Membersofcommunitieshistorically underrepresented in consulting are encouraged to apply.
Language Requirements
NA